Use sed to add a newline to the end of a file (this will perform an in-place replacement and create a backup file, MYFILE.bak):
$ sed -i.bak '$G' MYFILE
Some programs, such as Emacs, will omit the trailing newline from a file unless configured to add one. Emacs can be configured to add a newline automatically.
backupcommandsconfigurationeditorsemacsin-placeline-endingsnewlinesedshell
Show all DNS in 192.168.0.*; only if reverse DNS is enabled on DNS server:
$ for I in `seq 1 254`; do host 192.168.0.$I | grep ^[^Host] | sed "s/.in-addr.*pointer/ points to ---->\t/"; done
dnsshell
If you need a process to survive your logging out of the system (or being knocked off of it), you can either screen it or wrap it with nohup. If you nohup, you'll lose control of it entirely, but the output will be written to nohup.out. With screen you can re-attach and take control later:
# nohup program -opts args & -or- # screen (press 'ctrl+a d' to detach after you've run the proc)
commandsloginlogoutnohupprocessscreenshell
You can use awk to change the field separator in a data stream:
$ cat foo
a,b,c,d,e,f
a,b,c,d,e,f
$ awk 'BEGIN { FS = ","; OFS = ".."; } { $1 = $1; print }' foo
a..b..c..d..e..f
a..b..c..d..e..f
(You just have to touch one of the fields to get it to process the line.)
awkcommandsfieldsparsingshell
Ever been on a machine that was ailing and just wouldn't respond? As soon as you're root, lower the priority of the offending process ID(s) (in this example, 1103) by using the 'renice' command:
# renice -19 1103
commandsconfigurationcontroldebuggingmonitoringpriorityprocessrecoveryrenicerescuesecurityshell
There are a few different ways to convert a DOS file to Unix format, but the most available is probably this:
$ col -bx < dosfile > unixfile
colcommandsconvertdosfilterline-endingsnewlineshellunix
Convert a man page to HTML for easy viewing online:
$ gunzip < /usr/local/man/man8/lsof.8.gz | nroff -man | man2html -title "lsof" > otmp/lsof.html
commandsconvertfiltergunziphtmlman2htmlmanpagenroffonlineshell
Here is a way to copy an entire filesystem without descending down its subsumed mount points. This example uses the root filesystem:
$ find / -xdev | cpio -pm /desired/location
commandscopycpiofilesystemfindrootshell
If you need to see what queries are coming through your nameserver, toggle the querylog flag by typing:
$ rndc querylog
bindbind9commandsdnsnameserverquerylogrndcshell
Tired of typing your SSL password on boot of your webserver? You can decrypt it if you're certain it's safe:
# openssl rsa -in server.key -out server.key.unsecure
apachebootcommandsencryptionkeyopensslsecurityshellsslwebserver
You've entered a command with an option that didn't exist and somehow you now have a file that starts with a hyphen (i.e., -myfile). If you try to remove it, rm thinks that you're offering up the options m, y, f, i, l, and e. No good, but you can give this a try instead:
$ rm -- -myfile
The double-hyphen will disable option parsing and let you delete the file with no problem.
dashesoptionsrmshell
Make a recursive copy of your source tree before any changes (pristine version). E.g., copy project/ to project-pristine/.
After the changes, run this command:
$ diff -crN old new > output.diff - or - $ diff -crN project-pristine project > name_of_change.diff
On the target system in /path/to/project/../:
$ patch -p0 --dry-run < ./name_of_change.diff
Remove --dry-run to make it take effect.
commandsdiffpatchprogrammingshell
To create a .ico file that can be used for the favicon.ico on webpages, you can use a nice little program called png2ico. There is no package for this in Debian or Ubuntu so you will need to compile it yourself. Compilation is very straightforward. You do need a libpng package. Most of the time it will be installed but if you see an error, just searching for that file will yield the package you need to get for your distribution.
The session below uses /usr/local/src for the compilation and installed to /usr/local/bin. It can be compiled anywhere and installed anywhere, but having it in your $PATH makes things easier:
$ cd /usr/local/src $ wget http://www.winterdrache.de/freeware/png2ico/data/png2ico-src-2002-12-08.tar.gz $ tar xvzf png2ico-src-2002-12-08.tar.gz $ cd png2ico $ make $ sudo cp png2ico /usr/local/bin/ $ sudo cp doc/png2ico.1 /usr/local/man/man1/
Once compiled, upload your png images. They should be square; sizes 16x16 and 32x32 are suggested. To create the icon you would then call the following:
$ png2ico favicon.ico your_favicon16x16.png your_favicon32x32.png
Afterwards you will then have a favicon.ico file. You then place this in the webroot of your website add the following to <head></head> section of your webpages:
<link rel="shortcut icon" href="/favicon.ico" />
It's good form to include it, but most common browsers automatically look for an icon at that location.
http://www.winterdrache.de/freeware/png2ico/ - includes a windows gui
commandsconvertfaviconiconimagepng2icoshellweb
You need to get someone into an internal machine that doesn't have a public IP? Use an SSH tunnel. For this example, machine_a is your internal machine and machine_b is external:
$ ssh -R 9000:localhost:22 you@machine_b
Once you've logged in, you should be able to run this on machine_b:
$ ssh -p 9000 you@localhost
commandsnetworkshellsshtunnel
bzip2 -c largefile.txt | ssh user@hostname "bzip2 -dc > /home/user/myDir/largefile.txt"
Bascially it bzips the file on the fly whilst sending over ssh and decompressing at the other end on the target machine. Very useful for send large files over a vpn or slow connection.
It also saves time by combining all the processes into one.
I know you can use scp -C, but this is faster as it uses bzip.
You can also increase the compression on bzip to make the transfer size smaller, though this will increase processing time however if it's a very slow connection this should not matter.
bzip -c1 will compress at the highest compression ratio
bzipscpshellssh
If you want to tail the errors on another terminal, just push them to a fifo:
$ mkfifo pgerror $ psql -U user dbname < ./dbfile 2> pgerror
On your other terminal:
$ tail -f pgerror
Voila! STDOUT on the main terminal, and STDERR on the secondary.
commandserrorsmkfifopipepsqlredirectshelltailterminal
To zip up the contents of a directory (selectively), use find and zip:
$ find . -type f -name "*.jpg" | zip -@ myimages.zip
commandsdirectoryfindshellzip
If you need to find the process hogging your CPU, try this:
$ ps aux | awk '!/root|nobody/ { if ($4>2) {print $2}}'
awkcpuownerpipeprocessrootshelluser
An often-used concept in shell scripting is globbing. You can use this in python, as well:
import glob
for textFile in glob.glob("*.txt"):
# Do something with 'textFile'.
globimportlanguagesmodulesprogrammingpythonshell
You can have grep show only the filenames that matched (instead of showing all lines in those files that matched) by using the -l switch:
$ grep -l SELECT *.sql file1.sql file2.sql
grep will only list unique filenames (i.e. a file with two matches will only be listed once).
commandsgrepshellunique
A shell script which runs a sequence of commands will run them all even if some of them fail. This is rarely desirable, as later commands will usually depend on the success of prior ones.
You can use && between commands to implement this dependency, of course, or you can use the -e switch on the shebang line (works with bash, may work with other shells) to cause the interpreter to halt execution after any command returns a non-zero exit code:
#!/.../bash -e
bashhaltlogicoperatorsshell
If you need to know where a line ends, where unprintable characters lurk, and the difference between white space and tabs, you can always remember to take the cat to the vet:
$ <commands> | cat -vet
catcharacterscommandscrlfshell
This command will replace occurrences of foo with bar in the file X in-place and create a backup of X in X.old:
$ sed -i.old "s/foo/bar/g" filename
backupcommandsin-placesedshell
If you need to fool a machine into believing that a host:port pair is local, you can use ipchains to redirect traffic. For example, the desired destination is www.example.com:80 and you want it to go to localhost:8080:
# echo '1' > /proc/sys/net/ipv4/ip_forward # ipchains -A input -j REDIRECT 8080 -p tcp -s 0.0.0.0/0 -d 0.0.0.0/0 80
Note: No one really uses ipchains anymore, but it can be found on older systems.
commandsfirewallip_forwardipchainsloopredirectshell
You can use this in your shell dotfile (e.g. ~/.bash_profile, ~/.zshrc) to create a screen session when you log in or reattach to an existing screen:
if [[ $TERM != 'screen' ]] ; then
if [[ `screen -list | grep -v "No" | awk '$2 { print }' | wc -l` == 0 ]] ; then
screen
else
screen -dr
fi
fi
This works in bash and zsh.
attachbash_profilebootconfigurationscreenscreenrcsessionshellstartup
Since lsof is tragically broken in Solaris 10, you have to try other methods of finding out which ports a given PID has opened:
# pfiles 2602 &> output
That will redirect stdout and stderr to a file (output) that will outline any files (and ports; remember, everything is a file) that the process has open.
commandslsofpfilesshellsolaris
Given a log file with a date in the first column, chop up the file into separate file:
$ awk '/^[0-9]/ {print $0 > $1".log"}' logfile.txt
If you have a string that has characters that the shell won't like, you can do a substitution on them:
$ awk '{gsub("/","_",$1); print $1 > $1".log"}' logfile.txt
awkchoplogshellsplit
If you find yourself needing to drop the case on the entire contents of a file, you can try this:
$ dd if=original of=filtered conv=lcase -or- $ tr '[A-Z]' '[a-z]' < original > filtered
charactersconversionddfilterlowercaseshelltr
If you need to fetch a substring, but you have more than one delimiter, throw them all in there on the -F option to awk.
Given the text <VirtualHost 192.168.1.0:80>:
$ awk -F" |>" '/^<Virtual/ {print $2}'
Would return 192.168.1.0:80.
awkdelimitershell
To log into MySQL using the CLI in windows:
(in the mysql\bin directory) c:\mysql\bin> mysql --user=<user> --pass=<pass> --port=3306
commandlinecommandsmicrosoftmysqlshellwindows
Have you ever entered a command that involved redirection and just stared at it, palms sweating, heart racing, hoping against hope that, after all the variables interpolate, it doesn't destroy any of your crucial system files sitting nearby?
Enter: noclobber
If you're using the Bash shell, you can set this option to prevent overwriting of existing files. To see your current settings:
bash-2.05$ set -o allexport off braceexpand on errexit off hashall on histexpand on keyword off monitor on noclobber off ...
To set noclobber:
bash-2.05$ set -o noclobber
bashnoclobbershell
If you want to open an SSH tunnel in the background, use the -N and -f switches:
ssh -Nf -L2121:localhost:21 user@host
authenticationencryptionsecurityshellsshtunnel
If you want the time, and only the time:
$ date | (read u v w x y z; echo $x) 14:05:52
commandsdateextrasparsingshell
Add the following to your ~/.inputrc:
"\e[5~": history-search-backward "\e[6~": history-search-forward
And of course, in order to use your ~/.inputrc you need to set your INPUTRC environment variable in ~/.bash_profile:
export INPUTRC=$HOME/.inputrc
The next time you login you will be able to run "gvim <pageup>" and the last entry that started with "gvim " will appear, <pageup> again will bring the next one up, and so on.
Note that escape codes for PageUp and PageDown vary depending on your terminal type; check out this tip for a technique on how to find out what your terminal expects.
bashcommandshistoryinputrcshell
If you have a URL that you need to crawl and you know the range of numbers in the image, you can do something like this:
$ curl -O http://www.example.com/img/samples[00-99].jpg
That should (at least attempt to) fetch the images samples00.jpg through samples99.jpg. Enjoy!
If you're using more than one range, you'll want to build your filename or a path with the --create-dirs option. For example:
$ curl http://www.example.com/imgs[00-99]/samples[00-27].jpg --create-dirs -o "#1/#2.jpg"
Alternatively, you can just be ghetto and name the files like dirname_filename.jpg:
$ curl http://www.example.com/images[00-99]/samples[00-27].jpg -o "#1_#2.jpg"
commandscurlextrasimageshellurl
Download an entire directory tree:
$ wget -r ftp://username:password@site/path/to/suck
commandsdirectorydownloadftpshelltreewget
$ echo file.ext1.ext2 | cut -d"." -f1-2
cutextensionfileshshell
$ echo file.ext1.ext2 | sed 's/.[^.]*$//' file.ext1
extensionfilesedshshell
You can use tr to remove non-printable characters from a data stream:
$ tr -cd '\11\12\40-\176' < $INPUT_FILE > $OUTPUT_FILE
(This tip taken from http://www.devdaily.com/unix/edu/un010011/.)
charactersconvertfilternon-printableshelltr
If you find yourself on a machine without the semi-ubiquitous ImageMagick packages, you might at least have pnmscale. Starting with a PNG file, you can do the following to resize it to 450 pixels wide:
$ pngtopnm < ./firefox-upgrade.png | pnmscale -x 450 | cjpeg -smoo 100 -qual 100 > firefox-upgrade.jpg
cjpegcommandsconvertfilterimageimagemagickpngpngtopnmpnmscaleresizescaleshell
You can use the -l <kilobits_per_sec> option with scp (NOT ssh or sftp) to restrict the bandwidth used to transfer files:
$ scp -l 200 user@host:~/files .
bandwidthcommandsnetworkrate-limitingscpsftpshellssh
At the command line:
$ ruby -pe 'puts' < file.txt
double-spaceone-linersrubyshell
#prints line number 52 from file.txt $ ruby -pe 'next unless $. == 52' < file.txt
one-linersrubyshell
You can use the tee program to save the contents of a pipe to a file while also viewing it on standard out:
# tail -0f /var/log/httpd/error_log | tee ~/newest_errors.txt
Note: tail -0 instructs tail to begin at the very end of the file (the default is to show the last ten lines), and -f means tail will periodically check the file for additional data and print the data to standard out.
commandsdebuggingmonitoringpipeshellstdouttailteeutilities
If you're running scp -r, beware of symlinks; they are followed rather than preserved. This might be favorable behavior if you're referencing files outside what you're copying, but if you're copying symlinks which reference other parts of what you're copying, the referenced files will be duplicated on the destination host.
Take, for example, the following files on host A:
~/myfiles/
foo/
a.txt
bar/ -> foo/
When you run this command on host B:
joe@B:~$ scp -r joe@A:~/myfiles .
The result on host B will be:
~/myfiles/
foo/
a.txt
bar/
a.txt
commandsgotcharecursivescpshellsymlinks
You can use this command to show duplicate lines in a file:
$ uniq -d MYFILE
commandsduplicatesfiltershellsortuniq
This is a simple swap monitor script:
#!/bin/bash
# Notify me one time if my swap is over MAXSWAP and log the
# swap usage as well in SWAPLOG.
# Usage: ./monitor.sh &
SWAPLOG=~/logs/monitor/swap
MAXSWAP=5
INTERVAL=30
send_sms_msg () {
if [ "$1" ]; then STRING=$1; fi
if [ $SMS_SENT ]; then
return 0
else
echo $STRING | mailx -s 'monitor msg' 5101234567@cingularme.com
SMS_SENT=1
fi
}
while true; do
# parse free output, get current swap value
swaptest=`free -m |grep Swap|perl -pe 's/Swap:\s+\S+\s+(\S+).*/$1/'`
if [ $swaptest -ge $MAXSWAP ]; then
echo `date` Swap is: $swaptest >> $SWAPLOG
send_sms_msg "Swap is: $swaptest"
fi;
sleep $INTERVAL
done;
bashmemorymonitorscriptshellswaptools
You have a mailbox you need to sort. You can't have it come back through your MTA, of course. Use this script to push it through the procmail filter of your choice:
#!/bin/sh ORGMAIL=/var/spool/mail/$LOGNAME if cd $HOME && test -s $ORGMAIL && lockfile -r0 -l3600 .newmail.lock 2>/dev/null then trap "rm -f .newmail.lock" 1 2 3 15 umask 077 lockfile -l3600 -ml cat $ORGMAIL >>.newmail && cat /dev/null >$ORGMAIL lockfile -mu formail -s procmail <.newmail && rm -f .newmail rm -f .newmail.lock fi exit 0
commandsmailboxmtaprocmailscriptsshellsort
If you would like to have syntax highlighting on a file that would otherwise not have any highlighting at all, you can symlink the file to the appropriate extension and open it:
$ ln -s example.lxp example.html $ vi example.html # opened with pretty highlighting
*Note: This should be used sparingly and you should clean up your symlinks.
commandseditorshighlightingshellsymlinksyntaxvi
To transfer files via tar/ssh, do the following:
$ tar cvjf - * | ssh user@remote "(cd /desired/path; tar xjf -)"
commandspipeshellsshtartunnel
Netcat is handy little utility for scripting all manners of network functionality. Here we're making sure a web server is responding as we'd expect:
$ (echo "GET / HTTP/1.1"; echo "Host: www.xinu.org"; echo) | nc www.xinu.org 80
commandsdebuggingmonitoringnetcatnetworkshellutilities
Make sure you always specify a path free of symlinks. This can be pretty tough, though. An alternative approach is to use namei to track down symlinks:
# namei /usr/X11/bin/xterm f: /usr/X11/bin/xterm d / d usr l X11 -> X11R6 d X11R6 d bin - xterm
commandsdirectorynameipathshellsymlinkstree
If you need to upload an entire directory structure, check out wput on sourceforge.net. It works the same way as wget only in the other direction (i.e., supporting various protocols).
Thanks to Aronalle for this tip!
commandsdownloadnetworkshellsourceforgeuploadwgetwput
If you need to discover on which paths a binary depends, you can sometimes run strings on it and grep for everything starting with a slash:
# strings /usr/sbin/named | grep ^/ /lib/ld-linux.so.2 /etc/named.conf /etc/rndc.key /etc/lwresd.conf /etc/resolv.conf /var/run/named/named.pid /var/run/named/lwresd.pid /dev/null
binaryconfigurationgrepprocessshellstrings
Sometimes you need to iterate over variable names and access their values. In shell script, you would do something like this to get the values of FOO and BAR:
$ FOO=apple
$ BAR=orange
$ VARS="FOO BAR"
$ for v in $VARS ; do echo ${!v} ; done
The above works in bash. Use this in Zsh:
$ for v in $VARS ; do echo ${(P)v} ; done
(The 'P' flag on ${v} causes a further variable lookup before ${v} is evaluated.)
Thanks to Cliff for the tip!
bashcommandsenvironmentevaluationiterationloopshellzsh
If you want to use tcpdump to watch initiating connections (that is, the syn flag only is set indicating we're looking at the first third of the three-way handshake) on ports 80 and 443 you could do something like this:
# tcpdump '(tcp[13] & 0x3f = 2) and (dst port 80 or dst port 443)'
commandsconnectionsmonitoringnetworksecurityshelltcpdump
If you have a bunch of files in your home directory and you want to push them into ~/sort, create the directory and then do the following:
$ find . -type f -maxdepth 1 ! -name ".?*" | xargs -I '{}' mv '{}' sort
Note: GNU xargs uses -i. BSD versions use -I.
bsdcommandsdirectoryfindgnushellsortxargs
Let's say you want to check the uptime on a list of servers. We're assuming that you've got a key on each machine otherwise you'll be entering your password often:
$ xargs -i ssh {} uptime < ./server.list
5:46am up 155 days, 17:49, 2 users, load average: 0.12, 0.03, 0.01
5:46am up 147 days, 17:14, 2 users, load average: 0.02, 0.05, 0.01
5:46am up 209 days, 17:26, 0 users, load average: 0.00, 0.00, 0.00
5:46am up 89 days, 6:30, 0 users, load average: 0.00, 0.00, 0.00
5:46am up 82 days, 6:40, 0 users, load average: 0.07, 0.06, 0.01
5:46am up 104 days, 9:51, 0 users, load average: 0.03, 0.03, 0.00
5:50am up 68 days, 9:17, 0 users, load average: 0.00, 0.00, 0.00
5:48am up 68 days, 9:15, 0 users, load average: 0.00, 0.00, 0.00
commandskeyloopremoteserversshellsshuptimexargs